![Stratos Cinema](/img/default-banner.jpg)
- Видео 8
- Просмотров 70 241
Stratos Cinema
Швеция
Добавлен 14 фев 2011
Stratos Cinema is a full-service film production company from Dalarna, Sweden, founded 2011 by filmmakers Tom Grejs and Martin Flink. We produce feature films, documentaries, commercials, and branded content. For the last 10 years we have produced over 250 film projects and in 2022 we are realising our first feature film.
Eilert och Bosse- Isbanornas eldsjälar
Eilert och Bosse är byns eldsjälar. Med stort hjärta och engagemang ser de till att byns invånare kan åka skridskor den lilla tjärnen.
Просмотров: 71
Видео
Generation EV (Swedish short film)
Просмотров 4,6 тыс.2 года назад
SYNOPSIS Lisa with brand new driver’s license is looking to buy her first car. The car salesman tries to sell her an old-fashioned-manual-petrol car; however she is Generation EV, and have only ever driven electric vehicles. ABOUT THE FILM Type: Short Film Genre: Comedy/Drama Production: Stratos Cinema Titel: Generation EV Lenght: 7 min Language: Swedish Format: 4K-DCI (4096x2160) Filmed: Falun...
Midsommar i Dalarna (Vika) 2021
Просмотров 3,4 тыс.3 года назад
Denna film spelades in i syfte att ersätta det traditionsenliga midsommarfirandet som ej kunde genomföras p.g.a. pandemin. En annorlunda midsommar i Vika. En Stratos Cinema produktion. Foto/klipp Martin Flink
Drone Showreel with DJI Inspire 2. Stratos Cinema 2018
Просмотров 4,7 тыс.5 лет назад
A compilation of footage we've filmed during 2018. Mostly from Sweden and surroundings. Everything shot in 4K RAW or 422 with a DJI Inspire 2, Zenmuse X7 24 and 50mm. All gimbal stabilizing. Edit and grade done in DaVinci Resolve.
I Want to be a BASE jumper (documentary)
Просмотров 56 тыс.5 лет назад
BASE jumping is considered to be one of the world's most dangerous extreme sports where practitioners jump parachute from fixed objects. In 2015, and after many years of preparation, Carl-Oskar signs up to a course to learn how to jump from a mountain cliff for the first time. BASE jumping är en av världens farligaste extremsport där utövare hoppar fallskärm från fasta objekt. Efter många års f...
I want to be a BASE jumper (Documentary trailer)
Просмотров 6855 лет назад
BASE jumping is considered to be one of the world's most dangerous extreme sports where practitioners jump parachute from fixed objects. After many years of preparation, Carl-Oskar signs up to a course in BASE jumping. A Stratos Cinema production. A film by Martin Flink
Falun2015 - Officiell VM-vinjett
Просмотров 2099 лет назад
Officiella vinjetten för SkidVM Falun 2015 Klient: SVT Byrå: United Power Produkt: Vinjett Producerad av Stratos Cinema december 2014
Crazy !
Thank you so much for the inspiration. Im about to get startet on normal skydiving, but the idea of becoming a base jumper one day will defenetely stick in my head for while longer!
Dude lands first base jump, no one runs over to slap him five or give a hug? Huh.
Many years ago, I was standing on a beach in Zante (The one with the shipwreck), with a lovely lass, looking up at the cliff, and she said 'Would you be interested in doing the AFF course'......I WAS quite interested in the idea of getting into Wingsuit BASE, but seriously lacking in knowledge at the time. Didn't even know what an AFF course was.......She explained what it consisted of, and said that it was the first step to get into BASE jumping (Learning to skydive)....I agreed, and about 6 months later, I did a tandem to see IF I enjoyed it.....I DID enjoy it, and booked onto a course for the following Summer. After skydiving for about 5 or so years, ANY ideas of doing BASE had well and truly gone. I had become aware of the incredible level of skill required to do BASE without dying immediately, and also the fact that it's MASSIVELY more dangerous than skydive. Nope, not for me. Massive respect to the people who DO do it, but not for me. Bad enough losing friends in the skydive community, and I just wouldn't want to put my friends and family through the stress.
❤
Gravy Dan is such a good guy, I miss him...
is that Val?
Jhonathan Flórez 🙏👼🪽
How many have died since they recorded this documentary?
What do you need to be a BASE jumper? Class A?B?C?D? Also, can you use a regular skydiving container with two canopies or is there a container specifically for BASE jumping?
C=Min 200 jumps. Base uses specific container with one chute.
I looked, I even shed tears) congratulations to you! welcome!)))
did not spected alexanmder polli on it, rip and fly free dude, great video
Thank you
Wow,great film,respect🤘
Thanks!
Sam 😂🎉
Wow, it’s awesome! I will dream about it.
Thank you! Could you upload the Swedish subtles too? that way we learners can slowly start getting hold of the language..
Since getting sober this is my fucking dream!!
You can do it! Been sober since August '21, got my A License in August '22 with 41 jumps so far and cant wait to do more in 4 weeks! You need an adventure on your current path so give it to yourself. Makes it way easier to stay on it!
1112023datepaidswedenmovies2024datepaidweloveswedenmoviesvswelovemyanmarjustjehovashcompanyswedenladyprankvsmrtunzawusavisa2024usaembassyygnmyanmarnicechinmessivepaidwelovemyanmar
So cool. Really enjoyed their energy, thanks for capturing it. I was jumping 15 years before I got to do a slider up E! Still haven't been to Norway, just Lauterbrunnen and Brento over in Europe. So beautiful. Great movie!
Thanks!
Awesome movie. I would pay to watch this in a movie theater.
Thank you!
Good on you for following your dreams, just dont let your dreams kill you. It has killed many of my friends.
Swedish bible app
I recently did my first tandem and since then…. I can’t stop thinking about getting my AFF course!! Can’t stop dreaming about it!! And now you inspired me soo much with this film!! Great job thank you!!
Thank you! I felt the same after my first tandem jump, hehe. I actually started skydiving some weeks after my tandem (that's where I met Carl-Oskar), and now I have made a total of 180 jumps. At this moment I'm not an active skydiver anymore, I'm enjoying making movies instead. But it was one of the best time of my life, when I jumped out of an airplane by my own for the first time =) Highly recommend it.
Do it do it do it!!!
I got to do this in 2018, at the HeliBoogie.......FJC W/ Kim B. Words cannot describe. The words shared in this video post jump capture it, but you will never know the weight and amazement of those words without experiencing it.
Subscribed! This is different level! 🔥
insane camera and production work!!!
Thank you so much!
This is an absolutely stunning movie which deserves a lot more attention! Well done.
Thank you! /Martin
Almost 500 skydives and 0 base, i need to change that
These are my people:) can't wait to join!
I just realized that the movie was full commercial breaks. Sorry for that! It has been removed so you can watch the movie without interruption. /Martin
I stopped at the cafe there for breakfast 4 years ago on a motorcycle trip of Norway and had no idea it was a BASE school until i saw the helicopters taking people from the campsite and the yells from up high from the falling dots ..... spent ages and lost an hour and a half off our scheduled riding day as i love watching air sports and regularly visit the air games at Oludeniz in Turkey ....excellent video , many thanks
Thank you. It's an amazing place. I would love to get back there and just hike and watch (and maybe bring the camera again) =)
Big deal. Anybody could do that. At least once.
@M J hahah, it was a joke :)
What language is that?
It's Swedish. Most of the filming took place in Sweden and Norway /Martin
Fantastiskt fina drönarbilder!! 😊
motivational points.thanks for sharing.
Amazing video. This video got me into skydiving and pursuing base
Nice. Im a former skydiver myself but was more interested in filming BASE than to try it /Martin
Am I the only one who is more stressed by watching the video than them jumping down? :D
Hehe =)
Beautiful work.....
Тащить купол по земле, после приземления, это тоже самое, что совершить непотребный акт перед алтарем! Лысый идиот!
Sjukt intressant!! Vore otroligt roligt att få veta mer om Carl-Oskar. Särskilt om han fortsatt med Base. Går det att följa han någonstans, eller ännu bättre finns det mer planerat filmande med honom? Tack för en strålande dokumentär!
Carl-Oskar har inte fortsatt med Base, men håller på med speedriding och speedflyging ganska frekvent, det är när man åker skidor (speedriding) eller springer (speedflying)med en mindre skärm utför berg. Det finns inget mer planerad inspelning med honom i nuläget. Det här var en film som i början handlade om fyra personer som hoppade BASE, några från lyftkranar, andra från berg och Carl-Oskar som skulle gå en kurs. Men efter några års filmande var det en person som inte längre ville medverka så jag fick klippa om filmen så den enbart handlade om Carl-Oskar och hans äventyr. Lite synd, men så fick det bli. Carl-Oskar har en kanal med några få fallskärmsklipp på ruclips.net/user/CarlOskarBohlinvideos?view=0&sort=dd&shelf_id=0
@@stratos_cinema Jag förstår! Tack för uppdateringen. Vet du varför han valde att inte fortsätta med BASE?
@@skansown2 Det var så lite. Jag vet inte riktigt varför han inte fortsatt med BASE. /Martin
A very good video,i enjoyed it TY.
I´m glad to hear that /Martin
Beautiful! What`s the song name?
bro this is amazing !! sick shots n color grading FIRE
Thank you Cali!
Rip polli
He was amazing. Rest in peace, BSBD.
Brilliant video, thanks
Thank you, I´m glad you appreciate it!
say what?
Say what, what? =)
What is the name of the song that starts at 27 minutes?
drakeandjosh007 It’s music composed for this film by Johannes Andersson. So there’s no name :-)
Nice and smooth. Thanks for sharing...
I NEED to be a BASE jumper!!! I loved it, this is my dream!!! Very good job man!!!
Thanks man! Just sign up to a course, but only if you are an experienced skydiver=)
Leo Calix gimme $10k and I’ll make u one. I’m actually not joking if u live in Australia.
Stratos Cinema Bullshit. 😂😂
@@benc1978 Be careful. BASE is a serious sport. If someone reads this and has no experience in skydiving at all. Don't start with BASE-jumping. /Martin
Fantastic video. Love watching
Thanks!